Recombinant Mouse IL-11 protein(N-His)(active) Sizes: 20μg, 100μg Catalogue Numbers: PKSM041478-20, PKSM041478-100 Citations, Manuals and MSDS Available upon request. Abbreviation: IL-11 Target Symptom: Zcyto1; Zcyto10 Target Species: Mouse Expression Host: E.coli Application: Cell culture Fusion Tag: N-His UNIProt ID: P47873 Accession: P47873 Background: Interleukin-11(IL-11) is a secreted protein and belongs to the IL-6 superfamily. IL-11 has been demonstrated to improve platelet recovery after chemotherapy-induced thrombocytopenia, induceacute phase proteins, modulate antigen-antibody responses, participate in the regulation of bone cellproliferation and differentiation and could be use as a therapeutic for osteoporosis. IL-11 stimulates the growth of certain lymphocytes and, in the murine model, stimulates an increase in the cortical thickness and strength of long bones. In addition to having lymphopoietic/hematopoietic and osteotrophic properties, it has functions in many other tissues, including the brain, gut, testis and bone. Activity: Measure by its ability to induce T11 cells proliferation. The ED50 for this effect is < 0.5 ng/mL. The specific activity of recombinant mouse IL-11 is > 2 x 10⁶IU/mg. Sequence: MNCVCRLVLVVLSLWPDRVVAPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL Purity: > 98 % as determined by reducing SDS-PAGE. Formulation: Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. Reconstitution: Please refer to the printed manual for detailed information. Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method. Calculated MW: 22.35 kDa Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. Shipping: This product is provided as lyophilized powder which is shipped with ice packs. Research Use Only