20% OFF shipping at www.midwoodautocraft.com on orders over $79 + up to 10% OFF products
www.midwoodautocraft.com
home > IGF-1 LR3 > IGF-1 LR3
download picture
IGF-1 LR3IGF 1 LR3 Research Grade Peptide IGF 1 LR3 is a modified analog of insulin like growth factor 1 (IGF 1) studied for its role in cellular growth, anabolic signaling, and tissue repair pathways. It is designed to have lower affinity for IGF binding proteins than native IGF 1, which may increase biological availability in research settings.[1][2] Product Details Synonyms: Long R3 IGF 1; IGF 1 LR3; Long Arg3 IGF 1 Peptide Type: IGF 1 analog Sequence:
Shopping security

Shopping security

Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols

IGF-1 LR3 – Research Grade Peptide

IGF-1 LR3 is a modified analog of insulin-like growth factor-1 (IGF-1) studied for its role in cellular growth, anabolic signaling, and tissue repair pathways. It is designed to have lower affinity for IGF-binding proteins than native IGF-1, which may increase biological availability in research settings.[1][2]

Product Details

  • Synonyms: Long R3 IGF-1; IGF-1 LR3; Long Arg3 IGF-1
  • Peptide Type: IGF-1 analog
  • Sequence: MFPAMPLLSLFVNARPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Molecular Weight: 9117.60 g/mol
  • CAS Number: 946870-92-4
  • Solubility: Soluble in water (typically provided as acetate salt); reconstitute in sterile water or dilute acetic acid

For Research Use Only. This product is supplied for scientific research and laboratory use only, not for human or veterinary administration.

IGF-1 LR3

Item no : 59460169058
sold recently : Login >>
US$ 39.89
Pay in 4 interest-free payments of $9.97 Learn more
Min. order: 1piece

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 5 - Aug 10

Enjoy 20% off shipping

US$ 39.89

1-11

US$ 35.90

12-35

US$ 27.92

36-59

US$ 23.93

60+

US$40

Get now

Sign up to your membership to get coupons up to

15%

Get now

Opportunity to enjoy order discount up to 15% off

Please add the products
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

recommand products

Related Searches